PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g090310.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 261aa    MW: 28593.9 Da    PI: 8.625
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g090310.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.9e-3946104361
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         +++l+cprCds ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk+ 
  Sopim02g090310.0.1  46 SENLRCPRCDSPNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKSI 104
                         57899***************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.6E-3348103IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2549102IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.39449103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MIQELFAGNT TLIGDDNISN ITPSSSPISC TTSNSNIAPA SANANSENLR CPRCDSPNTK  60
FCYYNNYNLT QPRHFCKTCR RYWTKGGALR NVPIGGGCRK NKSIATSKST AAKFKNSLPF  120
EFIGKSGIFG GFEQEIIPSN YDNNNPFLFS SPHQNHNPIL SLLKGNLHKS IGVNQFPSNN  180
GIWKNNYEEN VGEVQNSRGF QELYQRLKAS TNRCYTDNMH GPSSSSMILD SAPVTGGELG  240
CWNPTLSTWL DLPTANGAYL *
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2265170.0AC226517.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02SLe0056J19, complete sequence.
GenBankAC2327740.0AC232774.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02SLe0056J10, complete sequence.
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232062.10.0PREDICTED: dof zinc finger protein DOF1.7-like
TrEMBLK4BCI00.0K4BCI0_SOLLC; Uncharacterized protein
STRINGSolyc02g090310.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-34DOF zinc finger protein 1